PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PDK_30s1140491g003
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Coryphoideae; Phoeniceae; Phoenix
Family MYB
Protein Properties Length: 1198aa    MW: 132074 Da    PI: 4.8978
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PDK_30s1140491g003genomePDKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.83e-145799143
                        TSSS-HH.HHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHH CS
     Myb_DNA-binding  1 rgrWTte.EdellvdavkqlGggtWktIartmgkgRtlkqcksr 43
                        rg WT+e Ede++++ v+++G++ W+tIa+ ++ gR +kqc++r
  PDK_30s1140491g003 57 RGQWTPEeEDEKIIEMVNKYGPKKWSTIAQALP-GRIGKQCRER 99
                        899**86268***********************.********98 PP

2Myb_DNA-binding475.7e-15232274145
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                         +++WT+eE+  l++a++ +G++ W+   + ++ gRt++ +k++w+
  PDK_30s1140491g003 232 KQAWTQEEEIALIHAHQVYGNK-WAELTKFLP-GRTDNAIKNHWN 274
                         799*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129420.75352108IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.4E-1656103IPR009057Homeodomain-like
SuperFamilySSF466893.74E-1156110IPR009057Homeodomain-like
SMARTSM007172.1E-1056106IPR001005SANT/Myb domain
PfamPF002491.2E-125799IPR001005SANT/Myb domain
CDDcd001674.31E-1260100No hitNo description
SuperFamilySSF466892.18E-20219282IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.0E-21222281IPR009057Homeodomain-like
PROSITE profilePS5129423.677227281IPR017930Myb domain
SMARTSM007175.6E-14231279IPR001005SANT/Myb domain
PfamPF002495.2E-13232275IPR001005SANT/Myb domain
CDDcd001679.03E-11234274No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
GO:0003713Molecular Functiontranscription coactivator activity
Sequence ? help Back to Top
Protein Sequence    Length: 1198 aa     Download sequence    Send to blast
MASEEGKGFK QGETSASAST SASTSTSSAV QGGRGDEIQR QRSFHGRTTG PTRRSTRGQW  60
TPEEEDEKII EMVNKYGPKK WSTIAQALPG RIGKQCRERM EDKYERQMIH MFTTYEEIGT  120
KSILGPFVEV GSQPRKILSL IVGTKTCLND KGSQYSPREE EPEGCLDLAK SIKDCDLAER  180
RKSLRVYWTM SRPIGAKRDT QFISTLDLVF SQASTSDSQK RWHNHLNPAI NKQAWTQEEE  240
IALIHAHQVY GNKWAELTKF LPGRTDNAIK NHWNSSVKKK LDSYLASGLL AQFQGLPHAE  300
NPAQCISSSV VNRQSSEDSG VKDRQEVEDS SECSKGSSSA LVSCYQSDYE LAISVHDDIK  360
LVEAAKKKDI QDSQLSMCSK EYYTSMEEIE CIVPEIECEP MVSVTAPCQN LHEIEVSERL  420
ANQMVSQELP NSLLEATQRL PELKRTSEYH THCVENHQNK SALFPDSGGL KMPTCITNSG  480
LESENQDKIL MAEAACCSGN IFGFPDSGGL KMPTCITNSG LESENQGKIL MAEAACCSGN  540
IFGAEMHQDI SMADPITAPN IINMDYYLGS PQYPANSSDM LGNSYCQSLM TVVPPSYICP  600
DNGKPVYRSD DAVTRNISVG TQDSELITCM YGGARSKICV PEDQDKENET LEQTYMEMMD  660
SEPPNATDNI TSSDENPAVQ TEEHQDAGAL FYEPPRFPSL EIPFVSCDLI SSGDLQQAYS  720
PLGIRQLMMS STPCSLWDSP SHDDSPDALL KNAARSFICT PSIMKKRQRE LLSPLQERRI  780
DKKSGIDTDH VLLSTPSISR TNNSLIDTMN DEGVAPRISS CSSEVDALYP SDHQKKKHEI  840
CLEQKENLDP THSYQKDEGA SMEAKARISS KETNTSIFQA KKEQCATAIC APTKLDAHVT  900
ENEPPAGVLV EHNTNDMLLF STDQDGHPVN GHMRTAARSL EDQTFTSFEI TSNKGHSDAR  960
SESLSDLSAP LSPRVGGSKL EQRQVPITSA QRALSVHPSA VSVEKHGSSI DMDLENLNIF  1020
ADTPGIKRGI ESPSAWKSPW FMNSLLPGHR IDTDITFEDI GYFVSPGDRT YDAIGLMRQL  1080
SEHTASAVAE AQEVLASGSP GVAFDKRHSG KEDFQKENIQ SDKELGDHPV TPKVMFSLDR  1140
LSSESTFLMS VIDLPSALTF PLGHPPLAWV DVILHKSASK LSYATWAADL APSNTNFV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-2621928346110B-MYB
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00466DAPTransfer from AT4G32730Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008800072.10.0PREDICTED: myb-related protein 3R-1-like isoform X1
RefseqXP_008800147.10.0PREDICTED: myb-related protein 3R-1-like isoform X1
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP24953879
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32730.14e-75Homeodomain-like protein